Anti CCDC166 pAb (ATL-HPA025058)

Atlas Antibodies

Catalog No.:
ATL-HPA025058-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 166
Gene Name: CCDC166
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098176: 37%, ENSRNOG00000047521: 37%
Entrez Gene ID: 100130274
Uniprot ID: P0CW27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSKVGSRMPSLTASRAGSRALSLVQSLEGSGISSGSSPRVSSQDTLRSTKSGPKLLSGLSRDRDPALLPPQSEDSVNAEAAAEAS
Gene Sequence TSKVGSRMPSLTASRAGSRALSLVQSLEGSGISSGSSPRVSSQDTLRSTKSGPKLLSGLSRDRDPALLPPQSEDSVNAEAAAEAS
Gene ID - Mouse ENSMUSG00000098176
Gene ID - Rat ENSRNOG00000047521
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC166 pAb (ATL-HPA025058)
Datasheet Anti CCDC166 pAb (ATL-HPA025058) Datasheet (External Link)
Vendor Page Anti CCDC166 pAb (ATL-HPA025058) at Atlas Antibodies

Documents & Links for Anti CCDC166 pAb (ATL-HPA025058)
Datasheet Anti CCDC166 pAb (ATL-HPA025058) Datasheet (External Link)
Vendor Page Anti CCDC166 pAb (ATL-HPA025058)