Anti CCDC159 pAb (ATL-HPA047126)

Atlas Antibodies

Catalog No.:
ATL-HPA047126-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 159
Gene Name: CCDC159
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006241: 70%, ENSRNOG00000011799: 73%
Entrez Gene ID: 126075
Uniprot ID: P0C7I6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENLVNIQKMQKTQVKCRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVLQNSIDSLTLCSGACPKASSLRGHKGHQC
Gene Sequence ENLVNIQKMQKTQVKCRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVLQNSIDSLTLCSGACPKASSLRGHKGHQC
Gene ID - Mouse ENSMUSG00000006241
Gene ID - Rat ENSRNOG00000011799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC159 pAb (ATL-HPA047126)
Datasheet Anti CCDC159 pAb (ATL-HPA047126) Datasheet (External Link)
Vendor Page Anti CCDC159 pAb (ATL-HPA047126) at Atlas Antibodies

Documents & Links for Anti CCDC159 pAb (ATL-HPA047126)
Datasheet Anti CCDC159 pAb (ATL-HPA047126) Datasheet (External Link)
Vendor Page Anti CCDC159 pAb (ATL-HPA047126)