Anti CCDC155 pAb (ATL-HPA019940 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019940-25

• 
• 

Protein Description: coiled-coil domain containing 155
Gene Name: CCDC155
Alternative Gene Name: FLJ32658, KASH5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038292: 80%, ENSRNOG00000025378: 85%
Entrez Gene ID: 147872
Uniprot ID: Q8N6L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLELEEETAFQGALTSRQLPSGCPEAEEPANLESFGGEDPRPELQATADLLSSLEDLELSNRRLVGENAKLQRSM
• Gene Sequence: GLELEEETAFQGALTSRQLPSGCPEAEEPANLESFGGEDPRPELQATADLLSSLEDLELSNRRLVGENAKLQRSM
• Gene ID - Mouse: ENSMUSG00000038292
• Gene ID - Rat: ENSRNOG00000025378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.