Anti CCDC154 pAb (ATL-HPA043535)

Atlas Antibodies

Catalog No.:
ATL-HPA043535-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 154
Gene Name: CCDC154
Alternative Gene Name: C16orf29, LOC645811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059562: 62%, ENSRNOG00000030541: 63%
Entrez Gene ID: 645811
Uniprot ID: A6NI56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMN
Gene Sequence TNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMN
Gene ID - Mouse ENSMUSG00000059562
Gene ID - Rat ENSRNOG00000030541
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC154 pAb (ATL-HPA043535)
Datasheet Anti CCDC154 pAb (ATL-HPA043535) Datasheet (External Link)
Vendor Page Anti CCDC154 pAb (ATL-HPA043535) at Atlas Antibodies

Documents & Links for Anti CCDC154 pAb (ATL-HPA043535)
Datasheet Anti CCDC154 pAb (ATL-HPA043535) Datasheet (External Link)
Vendor Page Anti CCDC154 pAb (ATL-HPA043535)