Anti CCDC154 pAb (ATL-HPA043535)

Atlas Antibodies

Catalog No.: ATL-HPA043535-25

Protein Description: coiled-coil domain containing 154
Gene Name: CCDC154
Alternative Gene Name: C16orf29, LOC645811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059562: 62%, ENSRNOG00000030541: 63%
Entrez Gene ID: 645811
Uniprot ID: A6NI56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMN
• Gene Sequence: TNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMN
• Gene ID - Mouse: ENSMUSG00000059562
• Gene ID - Rat: ENSRNOG00000030541
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.