Anti CCDC153 pAb (ATL-HPA041497 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041497-25
  • Immunohistochemical staining of human stomach, lower shows moderate cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CCDC153 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422411).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 153
Gene Name: CCDC153
Alternative Gene Name: LOC283152
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070306: 61%, ENSRNOG00000039086: 63%
Entrez Gene ID: 283152
Uniprot ID: Q494R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL
Gene Sequence REEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL
Gene ID - Mouse ENSMUSG00000070306
Gene ID - Rat ENSRNOG00000039086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CCDC153 pAb (ATL-HPA041497 w/enhanced validation)
Datasheet Anti CCDC153 pAb (ATL-HPA041497 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC153 pAb (ATL-HPA041497 w/enhanced validation)