Anti CCDC152 pAb (ATL-HPA036240)

Atlas Antibodies

Catalog No.:
ATL-HPA036240-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 152
Gene Name: CCDC152
Alternative Gene Name: LOC100129792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091119: 79%, ENSRNOG00000039473: 75%
Entrez Gene ID: 100129792
Uniprot ID: Q4G0S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF
Gene Sequence KEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF
Gene ID - Mouse ENSMUSG00000091119
Gene ID - Rat ENSRNOG00000039473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC152 pAb (ATL-HPA036240)
Datasheet Anti CCDC152 pAb (ATL-HPA036240) Datasheet (External Link)
Vendor Page Anti CCDC152 pAb (ATL-HPA036240) at Atlas Antibodies

Documents & Links for Anti CCDC152 pAb (ATL-HPA036240)
Datasheet Anti CCDC152 pAb (ATL-HPA036240) Datasheet (External Link)
Vendor Page Anti CCDC152 pAb (ATL-HPA036240)