Anti CCDC15 pAb (ATL-HPA041738)

Atlas Antibodies

SKU:
ATL-HPA041738-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 15
Gene Name: CCDC15
Alternative Gene Name: FLJ13215
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034303: 47%, ENSRNOG00000032180: 40%
Entrez Gene ID: 80071
Uniprot ID: Q0P6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQPASFMREERVREELPLDYHQYVVPKIQDQDSPREQNKHIKLPSSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKERQKQYLR
Gene Sequence QQPASFMREERVREELPLDYHQYVVPKIQDQDSPREQNKHIKLPSSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKERQKQYLR
Gene ID - Mouse ENSMUSG00000034303
Gene ID - Rat ENSRNOG00000032180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC15 pAb (ATL-HPA041738)
Datasheet Anti CCDC15 pAb (ATL-HPA041738) Datasheet (External Link)
Vendor Page Anti CCDC15 pAb (ATL-HPA041738) at Atlas Antibodies

Documents & Links for Anti CCDC15 pAb (ATL-HPA041738)
Datasheet Anti CCDC15 pAb (ATL-HPA041738) Datasheet (External Link)
Vendor Page Anti CCDC15 pAb (ATL-HPA041738)