Anti CCDC15 pAb (ATL-HPA041738)

Atlas Antibodies

Catalog No.: ATL-HPA041738-25

Protein Description: coiled-coil domain containing 15
Gene Name: CCDC15
Alternative Gene Name: FLJ13215
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034303: 47%, ENSRNOG00000032180: 40%
Entrez Gene ID: 80071
Uniprot ID: Q0P6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQPASFMREERVREELPLDYHQYVVPKIQDQDSPREQNKHIKLPSSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKERQKQYLR
• Gene Sequence: QQPASFMREERVREELPLDYHQYVVPKIQDQDSPREQNKHIKLPSSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKERQKQYLR
• Gene ID - Mouse: ENSMUSG00000034303
• Gene ID - Rat: ENSRNOG00000032180
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.