Anti CCDC15 pAb (ATL-HPA040450)

Atlas Antibodies

Catalog No.:
ATL-HPA040450-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 15
Gene Name: CCDC15
Alternative Gene Name: FLJ13215
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034303: 54%, ENSRNOG00000032180: 49%
Entrez Gene ID: 80071
Uniprot ID: Q0P6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKNKPFSRVQKVKFKNPLFVLMEEEEQKQLHFEGLQDILPEAQDYFLEAQGDLLETQGDLTGIQSVKPDTQAVEMKVQVT
Gene Sequence DKNKPFSRVQKVKFKNPLFVLMEEEEQKQLHFEGLQDILPEAQDYFLEAQGDLLETQGDLTGIQSVKPDTQAVEMKVQVT
Gene ID - Mouse ENSMUSG00000034303
Gene ID - Rat ENSRNOG00000032180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC15 pAb (ATL-HPA040450)
Datasheet Anti CCDC15 pAb (ATL-HPA040450) Datasheet (External Link)
Vendor Page Anti CCDC15 pAb (ATL-HPA040450) at Atlas Antibodies

Documents & Links for Anti CCDC15 pAb (ATL-HPA040450)
Datasheet Anti CCDC15 pAb (ATL-HPA040450) Datasheet (External Link)
Vendor Page Anti CCDC15 pAb (ATL-HPA040450)