Anti CCDC149 pAb (ATL-HPA044158)

Atlas Antibodies

Catalog No.:
ATL-HPA044158-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 149
Gene Name: CCDC149
Alternative Gene Name: DKFZp761B107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045790: 94%, ENSRNOG00000024454: 97%
Entrez Gene ID: 91050
Uniprot ID: Q6ZUS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHER
Gene Sequence RHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHER
Gene ID - Mouse ENSMUSG00000045790
Gene ID - Rat ENSRNOG00000024454
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC149 pAb (ATL-HPA044158)
Datasheet Anti CCDC149 pAb (ATL-HPA044158) Datasheet (External Link)
Vendor Page Anti CCDC149 pAb (ATL-HPA044158) at Atlas Antibodies

Documents & Links for Anti CCDC149 pAb (ATL-HPA044158)
Datasheet Anti CCDC149 pAb (ATL-HPA044158) Datasheet (External Link)
Vendor Page Anti CCDC149 pAb (ATL-HPA044158)