Anti CCDC149 pAb (ATL-HPA044158)

Atlas Antibodies

SKU: ATL-HPA044158-25

• 
• 
• 

Protein Description: coiled-coil domain containing 149
Gene Name: CCDC149
Alternative Gene Name: DKFZp761B107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045790: 94%, ENSRNOG00000024454: 97%
Entrez Gene ID: 91050
Uniprot ID: Q6ZUS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHER
• Gene Sequence: RHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHER
• Gene ID - Mouse: ENSMUSG00000045790
• Gene ID - Rat: ENSRNOG00000024454
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.