Anti CCDC146 pAb (ATL-HPA020105 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020105-25

• 
• 

Protein Description: coiled-coil domain containing 146
Gene Name: CCDC146
Alternative Gene Name: KIAA1505
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064280: 79%, ENSRNOG00000012932: 78%
Entrez Gene ID: 57639
Uniprot ID: Q8IYE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKKMNGYQRRIK
• Gene Sequence: KLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKKMNGYQRRIK
• Gene ID - Mouse: ENSMUSG00000064280
• Gene ID - Rat: ENSRNOG00000012932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.