Anti CCDC140 pAb (ATL-HPA042500)
Atlas Antibodies
- SKU:
- ATL-HPA042500-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCDC140
Alternative Gene Name: FLJ32447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055670: 29%, ENSRNOG00000022597: 30%
Entrez Gene ID: 151278
Uniprot ID: Q96MF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEAEEMKKKKERKRR |
Gene Sequence | SADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEAEEMKKKKERKRR |
Gene ID - Mouse | ENSMUSG00000055670 |
Gene ID - Rat | ENSRNOG00000022597 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC140 pAb (ATL-HPA042500) | |
Datasheet | Anti CCDC140 pAb (ATL-HPA042500) Datasheet (External Link) |
Vendor Page | Anti CCDC140 pAb (ATL-HPA042500) at Atlas Antibodies |
Documents & Links for Anti CCDC140 pAb (ATL-HPA042500) | |
Datasheet | Anti CCDC140 pAb (ATL-HPA042500) Datasheet (External Link) |
Vendor Page | Anti CCDC140 pAb (ATL-HPA042500) |