Anti CCDC140 pAb (ATL-HPA042500)

Atlas Antibodies

Catalog No.:
ATL-HPA042500-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 140
Gene Name: CCDC140
Alternative Gene Name: FLJ32447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055670: 29%, ENSRNOG00000022597: 30%
Entrez Gene ID: 151278
Uniprot ID: Q96MF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEAEEMKKKKERKRR
Gene Sequence SADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEAEEMKKKKERKRR
Gene ID - Mouse ENSMUSG00000055670
Gene ID - Rat ENSRNOG00000022597
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC140 pAb (ATL-HPA042500)
Datasheet Anti CCDC140 pAb (ATL-HPA042500) Datasheet (External Link)
Vendor Page Anti CCDC140 pAb (ATL-HPA042500) at Atlas Antibodies

Documents & Links for Anti CCDC140 pAb (ATL-HPA042500)
Datasheet Anti CCDC140 pAb (ATL-HPA042500) Datasheet (External Link)
Vendor Page Anti CCDC140 pAb (ATL-HPA042500)