Anti CCDC14 pAb (ATL-HPA035279)

Atlas Antibodies

Catalog No.:
ATL-HPA035279-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 14
Gene Name: CCDC14
Alternative Gene Name: DKFZp434L1050, FLJ12892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022833: 67%, ENSRNOG00000021469: 64%
Entrez Gene ID: 64770
Uniprot ID: Q49A88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIYQALCEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQTDGNSQFASQG
Gene Sequence IIYQALCEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQTDGNSQFASQG
Gene ID - Mouse ENSMUSG00000022833
Gene ID - Rat ENSRNOG00000021469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC14 pAb (ATL-HPA035279)
Datasheet Anti CCDC14 pAb (ATL-HPA035279) Datasheet (External Link)
Vendor Page Anti CCDC14 pAb (ATL-HPA035279) at Atlas Antibodies

Documents & Links for Anti CCDC14 pAb (ATL-HPA035279)
Datasheet Anti CCDC14 pAb (ATL-HPA035279) Datasheet (External Link)
Vendor Page Anti CCDC14 pAb (ATL-HPA035279)