Anti CCDC130 pAb (ATL-HPA056977)

Atlas Antibodies

Catalog No.:
ATL-HPA056977-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 130
Gene Name: CCDC130
Alternative Gene Name: MGC10471
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004994: 78%, ENSRNOG00000008319: 74%
Entrez Gene ID: 81576
Uniprot ID: P13994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALA
Gene Sequence QALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALA
Gene ID - Mouse ENSMUSG00000004994
Gene ID - Rat ENSRNOG00000008319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC130 pAb (ATL-HPA056977)
Datasheet Anti CCDC130 pAb (ATL-HPA056977) Datasheet (External Link)
Vendor Page Anti CCDC130 pAb (ATL-HPA056977) at Atlas Antibodies

Documents & Links for Anti CCDC130 pAb (ATL-HPA056977)
Datasheet Anti CCDC130 pAb (ATL-HPA056977) Datasheet (External Link)
Vendor Page Anti CCDC130 pAb (ATL-HPA056977)