Anti CCDC130 pAb (ATL-HPA056977)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056977-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CCDC130
Alternative Gene Name: MGC10471
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004994: 78%, ENSRNOG00000008319: 74%
Entrez Gene ID: 81576
Uniprot ID: P13994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALA |
| Gene Sequence | QALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALA |
| Gene ID - Mouse | ENSMUSG00000004994 |
| Gene ID - Rat | ENSRNOG00000008319 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC130 pAb (ATL-HPA056977) | |
| Datasheet | Anti CCDC130 pAb (ATL-HPA056977) Datasheet (External Link) |
| Vendor Page | Anti CCDC130 pAb (ATL-HPA056977) at Atlas Antibodies |
| Documents & Links for Anti CCDC130 pAb (ATL-HPA056977) | |
| Datasheet | Anti CCDC130 pAb (ATL-HPA056977) Datasheet (External Link) |
| Vendor Page | Anti CCDC130 pAb (ATL-HPA056977) |