Anti CCDC126 pAb (ATL-HPA010969)

Atlas Antibodies

SKU:
ATL-HPA010969-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 126
Gene Name: CCDC126
Alternative Gene Name: FLJ23031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050786: 89%, ENSRNOG00000009322: 89%
Entrez Gene ID: 90693
Uniprot ID: Q96EE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSI
Gene Sequence VKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSI
Gene ID - Mouse ENSMUSG00000050786
Gene ID - Rat ENSRNOG00000009322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC126 pAb (ATL-HPA010969)
Datasheet Anti CCDC126 pAb (ATL-HPA010969) Datasheet (External Link)
Vendor Page Anti CCDC126 pAb (ATL-HPA010969) at Atlas Antibodies

Documents & Links for Anti CCDC126 pAb (ATL-HPA010969)
Datasheet Anti CCDC126 pAb (ATL-HPA010969) Datasheet (External Link)
Vendor Page Anti CCDC126 pAb (ATL-HPA010969)