Anti CCDC125 pAb (ATL-HPA041878)

Atlas Antibodies

SKU:
ATL-HPA041878-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 125
Gene Name: CCDC125
Alternative Gene Name: KENAE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048924: 80%, ENSRNOG00000027410: 82%
Entrez Gene ID: 202243
Uniprot ID: Q86Z20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLNQRYLEALAMLDIKQQKMAQENMCCDKSGFAEASGLELAVLGACLCHGPGGNPCSCARMAASTRKLLLQLKQELEILQKSKEEAYVMADAFRIAFE
Gene Sequence VLNQRYLEALAMLDIKQQKMAQENMCCDKSGFAEASGLELAVLGACLCHGPGGNPCSCARMAASTRKLLLQLKQELEILQKSKEEAYVMADAFRIAFE
Gene ID - Mouse ENSMUSG00000048924
Gene ID - Rat ENSRNOG00000027410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC125 pAb (ATL-HPA041878)
Datasheet Anti CCDC125 pAb (ATL-HPA041878) Datasheet (External Link)
Vendor Page Anti CCDC125 pAb (ATL-HPA041878) at Atlas Antibodies

Documents & Links for Anti CCDC125 pAb (ATL-HPA041878)
Datasheet Anti CCDC125 pAb (ATL-HPA041878) Datasheet (External Link)
Vendor Page Anti CCDC125 pAb (ATL-HPA041878)