Anti CCDC122 pAb (ATL-HPA061456)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061456-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC122
Alternative Gene Name: FLJ31846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034795: 73%, ENSRNOG00000042404: 69%
Entrez Gene ID: 160857
Uniprot ID: Q5T0U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK |
Gene Sequence | NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK |
Gene ID - Mouse | ENSMUSG00000034795 |
Gene ID - Rat | ENSRNOG00000042404 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC122 pAb (ATL-HPA061456) | |
Datasheet | Anti CCDC122 pAb (ATL-HPA061456) Datasheet (External Link) |
Vendor Page | Anti CCDC122 pAb (ATL-HPA061456) at Atlas Antibodies |
Documents & Links for Anti CCDC122 pAb (ATL-HPA061456) | |
Datasheet | Anti CCDC122 pAb (ATL-HPA061456) Datasheet (External Link) |
Vendor Page | Anti CCDC122 pAb (ATL-HPA061456) |