Anti CCDC122 pAb (ATL-HPA061456)

Atlas Antibodies

SKU:
ATL-HPA061456-25
  • Immunohistochemical staining of human bronchus shows distinct cytoplasmic positivity in respiratory epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 122
Gene Name: CCDC122
Alternative Gene Name: FLJ31846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034795: 73%, ENSRNOG00000042404: 69%
Entrez Gene ID: 160857
Uniprot ID: Q5T0U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK
Gene Sequence NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK
Gene ID - Mouse ENSMUSG00000034795
Gene ID - Rat ENSRNOG00000042404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC122 pAb (ATL-HPA061456)
Datasheet Anti CCDC122 pAb (ATL-HPA061456) Datasheet (External Link)
Vendor Page Anti CCDC122 pAb (ATL-HPA061456) at Atlas Antibodies

Documents & Links for Anti CCDC122 pAb (ATL-HPA061456)
Datasheet Anti CCDC122 pAb (ATL-HPA061456) Datasheet (External Link)
Vendor Page Anti CCDC122 pAb (ATL-HPA061456)