Anti CCDC121 pAb (ATL-HPA051791)

Atlas Antibodies

Catalog No.:
ATL-HPA051791-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 121
Gene Name: CCDC121
Alternative Gene Name: FLJ13646, FLJ43364
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050625: 43%, ENSRNOG00000022717: 43%
Entrez Gene ID: 79635
Uniprot ID: Q6ZUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSL
Gene Sequence LNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSL
Gene ID - Mouse ENSMUSG00000050625
Gene ID - Rat ENSRNOG00000022717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC121 pAb (ATL-HPA051791)
Datasheet Anti CCDC121 pAb (ATL-HPA051791) Datasheet (External Link)
Vendor Page Anti CCDC121 pAb (ATL-HPA051791) at Atlas Antibodies

Documents & Links for Anti CCDC121 pAb (ATL-HPA051791)
Datasheet Anti CCDC121 pAb (ATL-HPA051791) Datasheet (External Link)
Vendor Page Anti CCDC121 pAb (ATL-HPA051791)