Anti CCDC12 pAb (ATL-HPA056814)

Atlas Antibodies

SKU:
ATL-HPA056814-25
  • Immunohistochemical staining of human stomach, lower shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 12
Gene Name: CCDC12
Alternative Gene Name: MGC23918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019659: 90%, ENSRNOG00000020946: 91%
Entrez Gene ID: 151903
Uniprot ID: Q8WUD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
Gene Sequence EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
Gene ID - Mouse ENSMUSG00000019659
Gene ID - Rat ENSRNOG00000020946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC12 pAb (ATL-HPA056814)
Datasheet Anti CCDC12 pAb (ATL-HPA056814) Datasheet (External Link)
Vendor Page Anti CCDC12 pAb (ATL-HPA056814) at Atlas Antibodies

Documents & Links for Anti CCDC12 pAb (ATL-HPA056814)
Datasheet Anti CCDC12 pAb (ATL-HPA056814) Datasheet (External Link)
Vendor Page Anti CCDC12 pAb (ATL-HPA056814)