Anti CCDC12 pAb (ATL-HPA056814)

Atlas Antibodies

Catalog No.: ATL-HPA056814-25

Protein Description: coiled-coil domain containing 12
Gene Name: CCDC12
Alternative Gene Name: MGC23918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019659: 90%, ENSRNOG00000020946: 91%
Entrez Gene ID: 151903
Uniprot ID: Q8WUD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
• Gene Sequence: EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
• Gene ID - Mouse: ENSMUSG00000019659
• Gene ID - Rat: ENSRNOG00000020946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.