Anti CCDC117 pAb (ATL-HPA000826)

Atlas Antibodies

SKU:
ATL-HPA000826-25
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, cytosol & microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 117
Gene Name: CCDC117
Alternative Gene Name: FLJ33814
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020482: 85%, ENSRNOG00000010706: 87%
Entrez Gene ID: 150275
Uniprot ID: Q8IWD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL
Gene Sequence GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL
Gene ID - Mouse ENSMUSG00000020482
Gene ID - Rat ENSRNOG00000010706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC117 pAb (ATL-HPA000826)
Datasheet Anti CCDC117 pAb (ATL-HPA000826) Datasheet (External Link)
Vendor Page Anti CCDC117 pAb (ATL-HPA000826) at Atlas Antibodies

Documents & Links for Anti CCDC117 pAb (ATL-HPA000826)
Datasheet Anti CCDC117 pAb (ATL-HPA000826) Datasheet (External Link)
Vendor Page Anti CCDC117 pAb (ATL-HPA000826)