Anti CCDC114 pAb (ATL-HPA042524)
Atlas Antibodies
- SKU:
- ATL-HPA042524-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCDC114
Alternative Gene Name: CILD20, FLJ32926
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040189: 68%, ENSRNOG00000021109: 70%
Entrez Gene ID: 93233
Uniprot ID: Q96M63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE |
Gene Sequence | SKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE |
Gene ID - Mouse | ENSMUSG00000040189 |
Gene ID - Rat | ENSRNOG00000021109 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC114 pAb (ATL-HPA042524) | |
Datasheet | Anti CCDC114 pAb (ATL-HPA042524) Datasheet (External Link) |
Vendor Page | Anti CCDC114 pAb (ATL-HPA042524) at Atlas Antibodies |
Documents & Links for Anti CCDC114 pAb (ATL-HPA042524) | |
Datasheet | Anti CCDC114 pAb (ATL-HPA042524) Datasheet (External Link) |
Vendor Page | Anti CCDC114 pAb (ATL-HPA042524) |
Citations for Anti CCDC114 pAb (ATL-HPA042524) – 6 Found |
Wallmeier, Julia; Shiratori, Hidetaka; Dougherty, Gerard W; Edelbusch, Christine; Hjeij, Rim; Loges, Niki T; Menchen, Tabea; Olbrich, Heike; Pennekamp, Petra; Raidt, Johanna; Werner, Claudius; Minegishi, Katsura; Shinohara, Kyosuke; Asai, Yasuko; Takaoka, Katsuyoshi; Lee, Chanjae; Griese, Matthias; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Sauer, Sascha; Wallingford, John B; Hamada, Hiroshi; Omran, Heymut. TTC25 Deficiency Results in Defects of the Outer Dynein Arm Docking Machinery and Primary Ciliary Dyskinesia with Left-Right Body Asymmetry Randomization. American Journal Of Human Genetics. 2016;99(2):460-9. PubMed |
Ta-Shma, Asaf; Hjeij, Rim; Perles, Zeev; Dougherty, Gerard W; Abu Zahira, Ibrahim; Letteboer, Stef J F; Antony, Dinu; Darwish, Alaa; Mans, Dorus A; Spittler, Sabrina; Edelbusch, Christine; Cindrić, Sandra; Nöthe-Menchen, Tabea; Olbrich, Heike; Stuhlmann, Friederike; Aprea, Isabella; Pennekamp, Petra; Loges, Niki T; Breuer, Oded; Shaag, Avraham; Rein, Azaria J J T; Gulec, Elif Yilmaz; Gezdirici, Alper; Abitbul, Revital; Elias, Nael; Amirav, Israel; Schmidts, Miriam; Roepman, Ronald; Elpeleg, Orly; Omran, Heymut. Homozygous loss-of-function mutations in MNS1 cause laterality defects and likely male infertility. Plos Genetics. 2018;14(8):e1007602. PubMed |
Ostrowski, Lawrence E; Yin, Weining; Smith, Amanda J; Sears, Patrick R; Bustamante-Marin, Ximena M; Dang, Hong; Hildebrandt, Friedhelm; Daniels, Leigh Anne; Capps, Nicole A; Sullivan, Kelli M; Leigh, Margaret W; Zariwala, Maimoona A; Knowles, Michael R. Expression of a Truncated Form of ODAD1 Associated with an Unusually Mild Primary Ciliary Dyskinesia Phenotype. International Journal Of Molecular Sciences. 2022;23(3) PubMed |
Onoufriadis, Alexandros; Paff, Tamara; Antony, Dinu; Shoemark, Amelia; Micha, Dimitra; Kuyt, Bertus; Schmidts, Miriam; Petridi, Stavroula; Dankert-Roelse, Jeanette E; Haarman, Eric G; Daniels, Johannes M A; Emes, Richard D; Wilson, Robert; Hogg, Claire; Scambler, Peter J; Chung, Eddie M K; Pals, Gerard; Mitchison, Hannah M. Splice-site mutations in the axonemal outer dynein arm docking complex gene CCDC114 cause primary ciliary dyskinesia. American Journal Of Human Genetics. 2013;92(1):88-98. PubMed |
Hjeij, Rim; Onoufriadis, Alexandros; Watson, Christopher M; Slagle, Christopher E; Klena, Nikolai T; Dougherty, Gerard W; Kurkowiak, Małgorzata; Loges, Niki T; Diggle, Christine P; Morante, Nicholas F C; Gabriel, George C; Lemke, Kristi L; Li, You; Pennekamp, Petra; Menchen, Tabea; Konert, Franziska; Marthin, June Kehlet; Mans, Dorus A; Letteboer, Stef J F; Werner, Claudius; Burgoyne, Thomas; Westermann, Cordula; Rutman, Andrew; Carr, Ian M; O'Callaghan, Christopher; Moya, Eduardo; Chung, Eddie M K; Sheridan, Eamonn; Nielsen, Kim G; Roepman, Ronald; Bartscherer, Kerstin; Burdine, Rebecca D; Lo, Cecilia W; Omran, Heymut; Mitchison, Hannah M. CCDC151 mutations cause primary ciliary dyskinesia by disruption of the outer dynein arm docking complex formation. American Journal Of Human Genetics. 2014;95(3):257-74. PubMed |
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |