Anti CCDC113 pAb (ATL-HPA040759)

Atlas Antibodies

Catalog No.:
ATL-HPA040759-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 113
Gene Name: CCDC113
Alternative Gene Name: DKFZp434N1418, HSPC065
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036598: 80%, ENSRNOG00000051510: 80%
Entrez Gene ID: 29070
Uniprot ID: Q9H0I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKV
Gene Sequence KLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKV
Gene ID - Mouse ENSMUSG00000036598
Gene ID - Rat ENSRNOG00000051510
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC113 pAb (ATL-HPA040759)
Datasheet Anti CCDC113 pAb (ATL-HPA040759) Datasheet (External Link)
Vendor Page Anti CCDC113 pAb (ATL-HPA040759) at Atlas Antibodies

Documents & Links for Anti CCDC113 pAb (ATL-HPA040759)
Datasheet Anti CCDC113 pAb (ATL-HPA040759) Datasheet (External Link)
Vendor Page Anti CCDC113 pAb (ATL-HPA040759)