Anti CCDC106 pAb (ATL-HPA043219)

Atlas Antibodies

SKU: ATL-HPA043219-25

• 
• 
• 

Protein Description: coiled-coil domain containing 106
Gene Name: CCDC106
Alternative Gene Name: HSU79303
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035228: 100%, ENSRNOG00000015997: 100%
Entrez Gene ID: 29903
Uniprot ID: Q9BWC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFK
• Gene Sequence: KLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFK
• Gene ID - Mouse: ENSMUSG00000035228
• Gene ID - Rat: ENSRNOG00000015997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.