Anti CCDC105 pAb (ATL-HPA058585)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058585-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC105
Alternative Gene Name: FLJ40365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078442: 79%, ENSRNOG00000007375: 79%
Entrez Gene ID: 126402
Uniprot ID: Q8IYK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR |
Gene Sequence | RDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR |
Gene ID - Mouse | ENSMUSG00000078442 |
Gene ID - Rat | ENSRNOG00000007375 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC105 pAb (ATL-HPA058585) | |
Datasheet | Anti CCDC105 pAb (ATL-HPA058585) Datasheet (External Link) |
Vendor Page | Anti CCDC105 pAb (ATL-HPA058585) at Atlas Antibodies |
Documents & Links for Anti CCDC105 pAb (ATL-HPA058585) | |
Datasheet | Anti CCDC105 pAb (ATL-HPA058585) Datasheet (External Link) |
Vendor Page | Anti CCDC105 pAb (ATL-HPA058585) |