Anti CCDC102A pAb (ATL-HPA040598)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040598-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC102A
Alternative Gene Name: MGC10992
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063605: 94%, ENSRNOG00000025843: 94%
Entrez Gene ID: 92922
Uniprot ID: Q96A19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD |
| Gene Sequence | SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD |
| Gene ID - Mouse | ENSMUSG00000063605 |
| Gene ID - Rat | ENSRNOG00000025843 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC102A pAb (ATL-HPA040598) | |
| Datasheet | Anti CCDC102A pAb (ATL-HPA040598) Datasheet (External Link) |
| Vendor Page | Anti CCDC102A pAb (ATL-HPA040598) at Atlas Antibodies |
| Documents & Links for Anti CCDC102A pAb (ATL-HPA040598) | |
| Datasheet | Anti CCDC102A pAb (ATL-HPA040598) Datasheet (External Link) |
| Vendor Page | Anti CCDC102A pAb (ATL-HPA040598) |
| Citations for Anti CCDC102A pAb (ATL-HPA040598) – 1 Found |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |