Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019943-25

Protein Description: cell cycle and apoptosis regulator 2
Gene Name: CCAR2
Alternative Gene Name: DBC-1, DBC1, KIAA1967, NET35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033712: 95%, ENSRNOG00000018295: 98%
Entrez Gene ID: 57805
Uniprot ID: Q8N163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
• Gene Sequence: RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
• Gene ID - Mouse: ENSMUSG00000033712
• Gene ID - Rat: ENSRNOG00000018295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.