Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019943-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA019943 antibody. Corresponding CCAR2 RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-CCAR2 antibody HPA019943 (A) shows similar pattern to independent antibody HPA019907 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cell cycle and apoptosis regulator 2
Gene Name: CCAR2
Alternative Gene Name: DBC-1, DBC1, KIAA1967, NET35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033712: 95%, ENSRNOG00000018295: 98%
Entrez Gene ID: 57805
Uniprot ID: Q8N163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
Gene Sequence RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
Gene ID - Mouse ENSMUSG00000033712
Gene ID - Rat ENSRNOG00000018295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation)
Datasheet Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation)
Datasheet Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCAR2 pAb (ATL-HPA019943 w/enhanced validation)