Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019907-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA019907 antibody. Corresponding CCAR2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis using Anti-CCAR2 antibody HPA019907 (A) shows similar pattern to independent antibody HPA019943 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cell cycle and apoptosis regulator 2
Gene Name: CCAR2
Alternative Gene Name: DBC-1, DBC1, KIAA1967, NET35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033712: 82%, ENSRNOG00000018295: 79%
Entrez Gene ID: 57805
Uniprot ID: Q8N163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD
Gene Sequence MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD
Gene ID - Mouse ENSMUSG00000033712
Gene ID - Rat ENSRNOG00000018295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation)
Datasheet Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation)
Datasheet Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation)



Citations for Anti CCAR2 pAb (ATL-HPA019907 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed