Anti CCAR1 pAb (ATL-HPA007856)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007856-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCAR1
Alternative Gene Name: CARP-1, CARP1, FLJ10590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020074: 93%, ENSRNOG00000000397: 94%
Entrez Gene ID: 55749
Uniprot ID: Q8IX12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED |
Gene Sequence | KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED |
Gene ID - Mouse | ENSMUSG00000020074 |
Gene ID - Rat | ENSRNOG00000000397 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCAR1 pAb (ATL-HPA007856) | |
Datasheet | Anti CCAR1 pAb (ATL-HPA007856) Datasheet (External Link) |
Vendor Page | Anti CCAR1 pAb (ATL-HPA007856) at Atlas Antibodies |
Documents & Links for Anti CCAR1 pAb (ATL-HPA007856) | |
Datasheet | Anti CCAR1 pAb (ATL-HPA007856) Datasheet (External Link) |
Vendor Page | Anti CCAR1 pAb (ATL-HPA007856) |
Citations for Anti CCAR1 pAb (ATL-HPA007856) – 3 Found |
Ha, Sang Yun; Kim, Jeong Hoon; Yang, Jung Wook; Kim, Jimin; Kim, Binnari; Park, Cheol-Keun. The Overexpression of CCAR1 in Hepatocellular Carcinoma Associates with Poor Prognosis. Cancer Research And Treatment. 2016;48(3):1065-73. PubMed |
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |