Anti CC2D2B pAb (ATL-HPA072122)

Atlas Antibodies

SKU: ATL-HPA072122-25

• 

Protein Description: coiled-coil and C2 domain containing 2B
Gene Name: CC2D2B
Alternative Gene Name: bA248J23.4, C10orf130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108929: 59%, ENSRNOG00000003596: 28%
Entrez Gene ID: 387707
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIK
• Gene Sequence: LSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIK
• Gene ID - Mouse: ENSMUSG00000108929
• Gene ID - Rat: ENSRNOG00000003596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.