Anti CC2D2B pAb (ATL-HPA072122)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072122-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CC2D2B
Alternative Gene Name: bA248J23.4, C10orf130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108929: 59%, ENSRNOG00000003596: 28%
Entrez Gene ID: 387707
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIK |
Gene Sequence | LSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIK |
Gene ID - Mouse | ENSMUSG00000108929 |
Gene ID - Rat | ENSRNOG00000003596 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CC2D2B pAb (ATL-HPA072122) | |
Datasheet | Anti CC2D2B pAb (ATL-HPA072122) Datasheet (External Link) |
Vendor Page | Anti CC2D2B pAb (ATL-HPA072122) at Atlas Antibodies |
Documents & Links for Anti CC2D2B pAb (ATL-HPA072122) | |
Datasheet | Anti CC2D2B pAb (ATL-HPA072122) Datasheet (External Link) |
Vendor Page | Anti CC2D2B pAb (ATL-HPA072122) |