Anti CC2D1B pAb (ATL-HPA027500)

Atlas Antibodies

SKU: ATL-HPA027500-25

• 

Protein Description: coiled-coil and C2 domain containing 1B
Gene Name: CC2D1B
Alternative Gene Name: KIAA1836
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028582: 68%, ENSRNOG00000008634: 63%
Entrez Gene ID: 200014
Uniprot ID: Q5T0F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA
• Gene Sequence: LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA
• Gene ID - Mouse: ENSMUSG00000028582
• Gene ID - Rat: ENSRNOG00000008634
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.