Anti CC2D1B pAb (ATL-HPA027500)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027500-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CC2D1B
Alternative Gene Name: KIAA1836
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028582: 68%, ENSRNOG00000008634: 63%
Entrez Gene ID: 200014
Uniprot ID: Q5T0F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA |
Gene Sequence | LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA |
Gene ID - Mouse | ENSMUSG00000028582 |
Gene ID - Rat | ENSRNOG00000008634 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CC2D1B pAb (ATL-HPA027500) | |
Datasheet | Anti CC2D1B pAb (ATL-HPA027500) Datasheet (External Link) |
Vendor Page | Anti CC2D1B pAb (ATL-HPA027500) at Atlas Antibodies |
Documents & Links for Anti CC2D1B pAb (ATL-HPA027500) | |
Datasheet | Anti CC2D1B pAb (ATL-HPA027500) Datasheet (External Link) |
Vendor Page | Anti CC2D1B pAb (ATL-HPA027500) |