Anti CC2D1A pAb (ATL-HPA005436 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005436-25

• 
• 

Protein Description: coiled-coil and C2 domain containing 1A
Gene Name: CC2D1A
Alternative Gene Name: FLJ20241, MRT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036686: 60%, ENSRNOG00000006747: 60%
Entrez Gene ID: 54862
Uniprot ID: Q6P1N0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE
• Gene Sequence: NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE
• Gene ID - Mouse: ENSMUSG00000036686
• Gene ID - Rat: ENSRNOG00000006747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CC2D1A pAb (ATL-HPA005436 w/enhanced validation) – 1 Found

Zhang, Guolin; Scarborough, Hannah; Kim, Jihye; Rozhok, Andrii I; Chen, Yian Ann; Zhang, Xiaohui; Song, Lanxi; Bai, Yun; Fang, Bin; Liu, Richard Z; Koomen, John; Tan, Aik Choon; Degregori, James; Haura, Eric B. Coupling an EML4-ALK-centric interactome with RNA interference identifies sensitizers to ALK inhibitors. Science Signaling. 2016;9(450):rs12.