Anti CBY3 pAb (ATL-HPA069037)

Atlas Antibodies

Catalog No.:
ATL-HPA069037-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chibby homolog 3 (Drosophila)
Gene Name: CBY3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050087: 53%, ENSRNOG00000003395: 47%
Entrez Gene ID: 646019
Uniprot ID: A6NI87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEVIPTAAARAGQRKMRKRAGASAGVLMIQPCALDS
Gene Sequence PEVIPTAAARAGQRKMRKRAGASAGVLMIQPCALDS
Gene ID - Mouse ENSMUSG00000050087
Gene ID - Rat ENSRNOG00000003395
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBY3 pAb (ATL-HPA069037)
Datasheet Anti CBY3 pAb (ATL-HPA069037) Datasheet (External Link)
Vendor Page Anti CBY3 pAb (ATL-HPA069037) at Atlas Antibodies

Documents & Links for Anti CBY3 pAb (ATL-HPA069037)
Datasheet Anti CBY3 pAb (ATL-HPA069037) Datasheet (External Link)
Vendor Page Anti CBY3 pAb (ATL-HPA069037)