Anti CBY3 pAb (ATL-HPA069037)
Atlas Antibodies
- SKU:
- ATL-HPA069037-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CBY3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050087: 53%, ENSRNOG00000003395: 47%
Entrez Gene ID: 646019
Uniprot ID: A6NI87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PEVIPTAAARAGQRKMRKRAGASAGVLMIQPCALDS |
Gene Sequence | PEVIPTAAARAGQRKMRKRAGASAGVLMIQPCALDS |
Gene ID - Mouse | ENSMUSG00000050087 |
Gene ID - Rat | ENSRNOG00000003395 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CBY3 pAb (ATL-HPA069037) | |
Datasheet | Anti CBY3 pAb (ATL-HPA069037) Datasheet (External Link) |
Vendor Page | Anti CBY3 pAb (ATL-HPA069037) at Atlas Antibodies |
Documents & Links for Anti CBY3 pAb (ATL-HPA069037) | |
Datasheet | Anti CBY3 pAb (ATL-HPA069037) Datasheet (External Link) |
Vendor Page | Anti CBY3 pAb (ATL-HPA069037) |