Anti CBX4 pAb (ATL-HPA012021)

Atlas Antibodies

Catalog No.:
ATL-HPA012021-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromobox homolog 4
Gene Name: CBX4
Alternative Gene Name: hPC2, NBP16, PC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039989: 92%, ENSRNOG00000046207: 92%
Entrez Gene ID: 8535
Uniprot ID: O00257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK
Gene Sequence SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK
Gene ID - Mouse ENSMUSG00000039989
Gene ID - Rat ENSRNOG00000046207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBX4 pAb (ATL-HPA012021)
Datasheet Anti CBX4 pAb (ATL-HPA012021) Datasheet (External Link)
Vendor Page Anti CBX4 pAb (ATL-HPA012021) at Atlas Antibodies

Documents & Links for Anti CBX4 pAb (ATL-HPA012021)
Datasheet Anti CBX4 pAb (ATL-HPA012021) Datasheet (External Link)
Vendor Page Anti CBX4 pAb (ATL-HPA012021)