Anti CBX4 pAb (ATL-HPA008228)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008228-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CBX4
Alternative Gene Name: hPC2, NBP16, PC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039989: 82%, ENSRNOG00000046207: 85%
Entrez Gene ID: 8535
Uniprot ID: O00257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV |
| Gene Sequence | QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV |
| Gene ID - Mouse | ENSMUSG00000039989 |
| Gene ID - Rat | ENSRNOG00000046207 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBX4 pAb (ATL-HPA008228) | |
| Datasheet | Anti CBX4 pAb (ATL-HPA008228) Datasheet (External Link) |
| Vendor Page | Anti CBX4 pAb (ATL-HPA008228) at Atlas Antibodies |
| Documents & Links for Anti CBX4 pAb (ATL-HPA008228) | |
| Datasheet | Anti CBX4 pAb (ATL-HPA008228) Datasheet (External Link) |
| Vendor Page | Anti CBX4 pAb (ATL-HPA008228) |
| Citations for Anti CBX4 pAb (ATL-HPA008228) – 1 Found |
| Peuget, S; Bonacci, T; Soubeyran, P; Iovanna, J; Dusetti, N J. Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation. Cell Death And Differentiation. 2014;21(7):1107-18. PubMed |