Anti CBX4 pAb (ATL-HPA008228)

Atlas Antibodies

Catalog No.: ATL-HPA008228-25

Protein Description: chromobox homolog 4
Gene Name: CBX4
Alternative Gene Name: hPC2, NBP16, PC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039989: 82%, ENSRNOG00000046207: 85%
Entrez Gene ID: 8535
Uniprot ID: O00257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
• Gene Sequence: QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
• Gene ID - Mouse: ENSMUSG00000039989
• Gene ID - Rat: ENSRNOG00000046207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CBX4 pAb (ATL-HPA008228) – 1 Found

Peuget, S; Bonacci, T; Soubeyran, P; Iovanna, J; Dusetti, N J. Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation. Cell Death And Differentiation. 2014;21(7):1107-18.