Anti CBX4 pAb (ATL-HPA008228)

Atlas Antibodies

SKU:
ATL-HPA008228-25
  • Immunohistochemical staining of human bone marrow shows strong nuclear positivity in subset of hematopoietic cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromobox homolog 4
Gene Name: CBX4
Alternative Gene Name: hPC2, NBP16, PC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039989: 82%, ENSRNOG00000046207: 85%
Entrez Gene ID: 8535
Uniprot ID: O00257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Gene Sequence QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Gene ID - Mouse ENSMUSG00000039989
Gene ID - Rat ENSRNOG00000046207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CBX4 pAb (ATL-HPA008228)
Datasheet Anti CBX4 pAb (ATL-HPA008228) Datasheet (External Link)
Vendor Page Anti CBX4 pAb (ATL-HPA008228) at Atlas Antibodies

Documents & Links for Anti CBX4 pAb (ATL-HPA008228)
Datasheet Anti CBX4 pAb (ATL-HPA008228) Datasheet (External Link)
Vendor Page Anti CBX4 pAb (ATL-HPA008228)



Citations for Anti CBX4 pAb (ATL-HPA008228) – 1 Found
Peuget, S; Bonacci, T; Soubeyran, P; Iovanna, J; Dusetti, N J. Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation. Cell Death And Differentiation. 2014;21(7):1107-18.  PubMed