Anti CBX2 pAb (ATL-HPA023083)

Atlas Antibodies

SKU: ATL-HPA023083-25

• 
• 

Protein Description: chromobox homolog 2
Gene Name: CBX2
Alternative Gene Name: CDCA6, MGC10561
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025577: 77%, ENSRNOG00000049215: 76%
Entrez Gene ID: 84733
Uniprot ID: Q14781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV
• Gene Sequence: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV
• Gene ID - Mouse: ENSMUSG00000025577
• Gene ID - Rat: ENSRNOG00000049215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CBX2 pAb (ATL-HPA023083) – 3 Found

Ueda, Sei; Kanda, Mitsuro; Sato, Yusuke; Baba, Hayato; Nakamura, Shunsuke; Sawaki, Koichi; Shimizu, Dai; Motoyama, Satoru; Fujii, Tsutomu; Kodera, Yasuhiro; Nomoto, Shuji. Chromobox 2 Expression Predicts Prognosis After Curative Resection of Oesophageal Squamous Cell Carcinoma. Cancer Genomics & Proteomics. 2020;17(4):391-400. 

Du, Xiaomei; Xue, Zhiwen; Lv, Jianning; Wang, Heidou. Expression of the Topoisomerase II Alpha (TOP2A) Gene in Lung Adenocarcinoma Cells and the Association with Patient Outcomes. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2020;26( 33361736):e929120. 

Eeftens, Jorine M; Kapoor, Manya; Michieletto, Davide; Brangwynne, Clifford P. Polycomb condensates can promote epigenetic marks but are not required for sustained chromatin compaction. Nature Communications. 2021;12(1):5888.