Anti CBX2 pAb (ATL-HPA023083)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023083-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CBX2
Alternative Gene Name: CDCA6, MGC10561
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025577: 77%, ENSRNOG00000049215: 76%
Entrez Gene ID: 84733
Uniprot ID: Q14781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV |
| Gene Sequence | KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV |
| Gene ID - Mouse | ENSMUSG00000025577 |
| Gene ID - Rat | ENSRNOG00000049215 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBX2 pAb (ATL-HPA023083) | |
| Datasheet | Anti CBX2 pAb (ATL-HPA023083) Datasheet (External Link) |
| Vendor Page | Anti CBX2 pAb (ATL-HPA023083) at Atlas Antibodies |
| Documents & Links for Anti CBX2 pAb (ATL-HPA023083) | |
| Datasheet | Anti CBX2 pAb (ATL-HPA023083) Datasheet (External Link) |
| Vendor Page | Anti CBX2 pAb (ATL-HPA023083) |
| Citations for Anti CBX2 pAb (ATL-HPA023083) – 3 Found |
| Ueda, Sei; Kanda, Mitsuro; Sato, Yusuke; Baba, Hayato; Nakamura, Shunsuke; Sawaki, Koichi; Shimizu, Dai; Motoyama, Satoru; Fujii, Tsutomu; Kodera, Yasuhiro; Nomoto, Shuji. Chromobox 2 Expression Predicts Prognosis After Curative Resection of Oesophageal Squamous Cell Carcinoma. Cancer Genomics & Proteomics. 2020;17(4):391-400. PubMed |
| Du, Xiaomei; Xue, Zhiwen; Lv, Jianning; Wang, Heidou. Expression of the Topoisomerase II Alpha (TOP2A) Gene in Lung Adenocarcinoma Cells and the Association with Patient Outcomes. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2020;26( 33361736):e929120. PubMed |
| Eeftens, Jorine M; Kapoor, Manya; Michieletto, Davide; Brangwynne, Clifford P. Polycomb condensates can promote epigenetic marks but are not required for sustained chromatin compaction. Nature Communications. 2021;12(1):5888. PubMed |