Anti CBWD1 pAb (ATL-HPA042813)
Atlas Antibodies
- SKU:
- ATL-HPA042813-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CBWD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024878: 97%, ENSRNOG00000015516: 97%
Entrez Gene ID: 55871
Uniprot ID: Q9BRT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK |
Gene Sequence | EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK |
Gene ID - Mouse | ENSMUSG00000024878 |
Gene ID - Rat | ENSRNOG00000015516 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CBWD1 pAb (ATL-HPA042813) | |
Datasheet | Anti CBWD1 pAb (ATL-HPA042813) Datasheet (External Link) |
Vendor Page | Anti CBWD1 pAb (ATL-HPA042813) at Atlas Antibodies |
Documents & Links for Anti CBWD1 pAb (ATL-HPA042813) | |
Datasheet | Anti CBWD1 pAb (ATL-HPA042813) Datasheet (External Link) |
Vendor Page | Anti CBWD1 pAb (ATL-HPA042813) |