Anti CBWD1 pAb (ATL-HPA042813)

Atlas Antibodies

Catalog No.:
ATL-HPA042813-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: COBW domain containing 1
Gene Name: CBWD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024878: 97%, ENSRNOG00000015516: 97%
Entrez Gene ID: 55871
Uniprot ID: Q9BRT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK
Gene Sequence EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK
Gene ID - Mouse ENSMUSG00000024878
Gene ID - Rat ENSRNOG00000015516
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBWD1 pAb (ATL-HPA042813)
Datasheet Anti CBWD1 pAb (ATL-HPA042813) Datasheet (External Link)
Vendor Page Anti CBWD1 pAb (ATL-HPA042813) at Atlas Antibodies

Documents & Links for Anti CBWD1 pAb (ATL-HPA042813)
Datasheet Anti CBWD1 pAb (ATL-HPA042813) Datasheet (External Link)
Vendor Page Anti CBWD1 pAb (ATL-HPA042813)