Anti CBS pAb (ATL-HPA001223)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001223-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $395.00
    
         
                            Gene Name: CBS
Alternative Gene Name: HIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024039: 92%, ENSRNOG00000029528: 92%
Entrez Gene ID: 875
Uniprot ID: P35520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR | 
| Gene Sequence | GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR | 
| Gene ID - Mouse | ENSMUSG00000024039 | 
| Gene ID - Rat | ENSRNOG00000029528 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti CBS pAb (ATL-HPA001223) | |
| Datasheet | Anti CBS pAb (ATL-HPA001223) Datasheet (External Link) | 
| Vendor Page | Anti CBS pAb (ATL-HPA001223) at Atlas Antibodies | 
| Documents & Links for Anti CBS pAb (ATL-HPA001223) | |
| Datasheet | Anti CBS pAb (ATL-HPA001223) Datasheet (External Link) | 
| Vendor Page | Anti CBS pAb (ATL-HPA001223) | 
| Citations for Anti CBS pAb (ATL-HPA001223) – 1 Found | 
| Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965. PubMed | 
 
         
                             
                                        