Anti CBS pAb (ATL-HPA001223)

Atlas Antibodies

Catalog No.:
ATL-HPA001223-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cystathionine-beta-synthase
Gene Name: CBS
Alternative Gene Name: HIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024039: 92%, ENSRNOG00000029528: 92%
Entrez Gene ID: 875
Uniprot ID: P35520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR
Gene Sequence GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR
Gene ID - Mouse ENSMUSG00000024039
Gene ID - Rat ENSRNOG00000029528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBS pAb (ATL-HPA001223)
Datasheet Anti CBS pAb (ATL-HPA001223) Datasheet (External Link)
Vendor Page Anti CBS pAb (ATL-HPA001223) at Atlas Antibodies

Documents & Links for Anti CBS pAb (ATL-HPA001223)
Datasheet Anti CBS pAb (ATL-HPA001223) Datasheet (External Link)
Vendor Page Anti CBS pAb (ATL-HPA001223)
Citations for Anti CBS pAb (ATL-HPA001223) – 1 Found
Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965.  PubMed