Anti CBR3 pAb (ATL-HPA018434)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018434-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CBR3
Alternative Gene Name: SDR21C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022947: 82%, ENSRNOG00000001701: 83%
Entrez Gene ID: 874
Uniprot ID: O75828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
| Gene Sequence | DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
| Gene ID - Mouse | ENSMUSG00000022947 |
| Gene ID - Rat | ENSRNOG00000001701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBR3 pAb (ATL-HPA018434) | |
| Datasheet | Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link) |
| Vendor Page | Anti CBR3 pAb (ATL-HPA018434) at Atlas Antibodies |
| Documents & Links for Anti CBR3 pAb (ATL-HPA018434) | |
| Datasheet | Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link) |
| Vendor Page | Anti CBR3 pAb (ATL-HPA018434) |