Anti CBR3 pAb (ATL-HPA018434)

Atlas Antibodies

SKU: ATL-HPA018434-25

• 
• 
• 

Protein Description: carbonyl reductase 3
Gene Name: CBR3
Alternative Gene Name: SDR21C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022947: 82%, ENSRNOG00000001701: 83%
Entrez Gene ID: 874
Uniprot ID: O75828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK
• Gene Sequence: DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK
• Gene ID - Mouse: ENSMUSG00000022947
• Gene ID - Rat: ENSRNOG00000001701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.