Anti CBR3 pAb (ATL-HPA018434)

Atlas Antibodies

Catalog No.:
ATL-HPA018434-25
Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in lymphocytes outside reaction center cells.
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carbonyl reductase 3
Gene Name: CBR3
Alternative Gene Name: SDR21C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022947: 82%, ENSRNOG00000001701: 83%
Entrez Gene ID: 874
Uniprot ID: O75828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK
Gene Sequence DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK
Gene ID - Mouse ENSMUSG00000022947
Gene ID - Rat ENSRNOG00000001701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBR3 pAb (ATL-HPA018434)
Datasheet Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link)
Vendor Page Anti CBR3 pAb (ATL-HPA018434) at Atlas Antibodies

Documents & Links for Anti CBR3 pAb (ATL-HPA018434)
Datasheet Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link)
Vendor Page Anti CBR3 pAb (ATL-HPA018434)
!