Anti CBR1 pAb (ATL-HPA018433)

Atlas Antibodies

Catalog No.: ATL-HPA018433-25

Protein Description: carbonyl reductase 1
Gene Name: CBR1
Alternative Gene Name: CBR, SDR21C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051483: 91%, ENSRNOG00000049911: 92%
Entrez Gene ID: 873
Uniprot ID: P16152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
• Gene Sequence: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
• Gene ID - Mouse: ENSMUSG00000051483
• Gene ID - Rat: ENSRNOG00000049911
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.