Anti CBR1 pAb (ATL-HPA018433)

Atlas Antibodies

Catalog No.:
ATL-HPA018433-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: carbonyl reductase 1
Gene Name: CBR1
Alternative Gene Name: CBR, SDR21C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051483: 91%, ENSRNOG00000049911: 92%
Entrez Gene ID: 873
Uniprot ID: P16152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
Gene Sequence TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
Gene ID - Mouse ENSMUSG00000051483
Gene ID - Rat ENSRNOG00000049911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBR1 pAb (ATL-HPA018433)
Datasheet Anti CBR1 pAb (ATL-HPA018433) Datasheet (External Link)
Vendor Page Anti CBR1 pAb (ATL-HPA018433) at Atlas Antibodies

Documents & Links for Anti CBR1 pAb (ATL-HPA018433)
Datasheet Anti CBR1 pAb (ATL-HPA018433) Datasheet (External Link)
Vendor Page Anti CBR1 pAb (ATL-HPA018433)