Anti CBR1 pAb (ATL-HPA018433)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018433-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CBR1
Alternative Gene Name: CBR, SDR21C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051483: 91%, ENSRNOG00000049911: 92%
Entrez Gene ID: 873
Uniprot ID: P16152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE |
Gene Sequence | TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE |
Gene ID - Mouse | ENSMUSG00000051483 |
Gene ID - Rat | ENSRNOG00000049911 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CBR1 pAb (ATL-HPA018433) | |
Datasheet | Anti CBR1 pAb (ATL-HPA018433) Datasheet (External Link) |
Vendor Page | Anti CBR1 pAb (ATL-HPA018433) at Atlas Antibodies |
Documents & Links for Anti CBR1 pAb (ATL-HPA018433) | |
Datasheet | Anti CBR1 pAb (ATL-HPA018433) Datasheet (External Link) |
Vendor Page | Anti CBR1 pAb (ATL-HPA018433) |