Anti CBLN3 pAb (ATL-HPA041266)

Atlas Antibodies

Catalog No.:
ATL-HPA041266-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: cerebellin 3 precursor
Gene Name: CBLN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040380: 97%, ENSRNOG00000020503: 96%
Entrez Gene ID: 643866
Uniprot ID: Q6UW01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV
Gene Sequence GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV
Gene ID - Mouse ENSMUSG00000040380
Gene ID - Rat ENSRNOG00000020503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBLN3 pAb (ATL-HPA041266)
Datasheet Anti CBLN3 pAb (ATL-HPA041266) Datasheet (External Link)
Vendor Page Anti CBLN3 pAb (ATL-HPA041266) at Atlas Antibodies

Documents & Links for Anti CBLN3 pAb (ATL-HPA041266)
Datasheet Anti CBLN3 pAb (ATL-HPA041266) Datasheet (External Link)
Vendor Page Anti CBLN3 pAb (ATL-HPA041266)