Anti CBLN3 pAb (ATL-HPA041266)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041266-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: CBLN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040380: 97%, ENSRNOG00000020503: 96%
Entrez Gene ID: 643866
Uniprot ID: Q6UW01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV |
| Gene Sequence | GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV |
| Gene ID - Mouse | ENSMUSG00000040380 |
| Gene ID - Rat | ENSRNOG00000020503 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBLN3 pAb (ATL-HPA041266) | |
| Datasheet | Anti CBLN3 pAb (ATL-HPA041266) Datasheet (External Link) |
| Vendor Page | Anti CBLN3 pAb (ATL-HPA041266) at Atlas Antibodies |
| Documents & Links for Anti CBLN3 pAb (ATL-HPA041266) | |
| Datasheet | Anti CBLN3 pAb (ATL-HPA041266) Datasheet (External Link) |
| Vendor Page | Anti CBLN3 pAb (ATL-HPA041266) |