Anti CBLN3 pAb (ATL-HPA041266)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041266-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CBLN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040380: 97%, ENSRNOG00000020503: 96%
Entrez Gene ID: 643866
Uniprot ID: Q6UW01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV |
Gene Sequence | GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV |
Gene ID - Mouse | ENSMUSG00000040380 |
Gene ID - Rat | ENSRNOG00000020503 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CBLN3 pAb (ATL-HPA041266) | |
Datasheet | Anti CBLN3 pAb (ATL-HPA041266) Datasheet (External Link) |
Vendor Page | Anti CBLN3 pAb (ATL-HPA041266) at Atlas Antibodies |
Documents & Links for Anti CBLN3 pAb (ATL-HPA041266) | |
Datasheet | Anti CBLN3 pAb (ATL-HPA041266) Datasheet (External Link) |
Vendor Page | Anti CBLN3 pAb (ATL-HPA041266) |