Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021773-25

Protein Description: Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase
Gene Name: CBLL1
Alternative Gene Name: FLJ23109, HAKAI, RNF188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020659: 99%, ENSRNOG00000007253: 99%
Entrez Gene ID: 79872
Uniprot ID: Q75N03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP
• Gene Sequence: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP
• Gene ID - Mouse: ENSMUSG00000020659
• Gene ID - Rat: ENSRNOG00000007253
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) – 1 Found

Hui, Linping; Zhang, Siyang; Wudu, Muli; Ren, Hongjiu; Xu, Yitong; Zhang, Qingfu; Qiu, Xueshan. CBLL1 is highly expressed in non-small cell lung cancer and promotes cell proliferation and invasion. Thoracic Cancer. 2019;10(6):1479-1488.