Anti CBLC pAb (ATL-HPA035266)

Atlas Antibodies

Catalog No.: ATL-HPA035266-25

Protein Description: Cbl proto-oncogene C, E3 ubiquitin protein ligase
Gene Name: CBLC
Alternative Gene Name: CBL-3, CBL-SL, RNF57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040525: 67%, ENSRNOG00000018953: 74%
Entrez Gene ID: 23624
Uniprot ID: Q9ULV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
• Gene Sequence: GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
• Gene ID - Mouse: ENSMUSG00000040525
• Gene ID - Rat: ENSRNOG00000018953
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.