Anti CBLB pAb (ATL-HPA019880)

Atlas Antibodies

Catalog No.:
ATL-HPA019880-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Cbl proto-oncogene B, E3 ubiquitin protein ligase
Gene Name: CBLB
Alternative Gene Name: Cbl-b, RNF56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022637: 85%, ENSRNOG00000001982: 84%
Entrez Gene ID: 868
Uniprot ID: Q13191
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA
Gene Sequence DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA
Gene ID - Mouse ENSMUSG00000022637
Gene ID - Rat ENSRNOG00000001982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBLB pAb (ATL-HPA019880)
Datasheet Anti CBLB pAb (ATL-HPA019880) Datasheet (External Link)
Vendor Page Anti CBLB pAb (ATL-HPA019880) at Atlas Antibodies

Documents & Links for Anti CBLB pAb (ATL-HPA019880)
Datasheet Anti CBLB pAb (ATL-HPA019880) Datasheet (External Link)
Vendor Page Anti CBLB pAb (ATL-HPA019880)
Citations for Anti CBLB pAb (ATL-HPA019880) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed