Anti CBLB pAb (ATL-HPA019880)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019880-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CBLB
Alternative Gene Name: Cbl-b, RNF56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022637: 85%, ENSRNOG00000001982: 84%
Entrez Gene ID: 868
Uniprot ID: Q13191
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA |
| Gene Sequence | DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA |
| Gene ID - Mouse | ENSMUSG00000022637 |
| Gene ID - Rat | ENSRNOG00000001982 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBLB pAb (ATL-HPA019880) | |
| Datasheet | Anti CBLB pAb (ATL-HPA019880) Datasheet (External Link) |
| Vendor Page | Anti CBLB pAb (ATL-HPA019880) at Atlas Antibodies |
| Documents & Links for Anti CBLB pAb (ATL-HPA019880) | |
| Datasheet | Anti CBLB pAb (ATL-HPA019880) Datasheet (External Link) |
| Vendor Page | Anti CBLB pAb (ATL-HPA019880) |
| Citations for Anti CBLB pAb (ATL-HPA019880) – 1 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |