Anti CBLB pAb (ATL-HPA018327)

Atlas Antibodies

Catalog No.: ATL-HPA018327-25

Protein Description: Cbl proto-oncogene B, E3 ubiquitin protein ligase
Gene Name: CBLB
Alternative Gene Name: Cbl-b, RNF56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022637: 87%, ENSRNOG00000001982: 91%
Entrez Gene ID: 868
Uniprot ID: Q13191
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP
• Gene Sequence: PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP
• Gene ID - Mouse: ENSMUSG00000022637
• Gene ID - Rat: ENSRNOG00000001982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.