Anti CBL pAb (ATL-HPA027956 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027956-25

Protein Description: Cbl proto-oncogene, E3 ubiquitin protein ligase
Gene Name: CBL
Alternative Gene Name: c-Cbl, CBL2, RNF55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034342: 83%, ENSRNOG00000008444: 84%
Entrez Gene ID: 867
Uniprot ID: P22681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
• Gene Sequence: PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
• Gene ID - Mouse: ENSMUSG00000034342
• Gene ID - Rat: ENSRNOG00000008444
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) – 2 Found

He, Qing-Lin; Qin, Shan-Yu; Tao, Lin; Ning, Hong-Jian; Jiang, Hai-Xing. Prognostic value and prospective molecular mechanism of miR-100-5p in hepatocellular carcinoma: A comprehensive study based on 1,258 samples. Oncology Letters. 2019;18(6):6126-6142. 

Rodriguez-Polo, Ignacio; Nielsen, Maike; Debowski, Katharina; Behr, Rüdiger. The ubiquitin ligase c-CBL is expressed in undifferentiated marmoset monkey pluripotent stem cells but is not a general stem cell marker. Primate Biology. 4(2):231-240.