Anti CBFB pAb (ATL-HPA038852 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038852-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: core-binding factor, beta subunit
Gene Name: CBFB
Alternative Gene Name: PEBP2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031885: 99%, ENSRNOG00000014647: 99%
Entrez Gene ID: 865
Uniprot ID: Q13951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV
Gene Sequence SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV
Gene ID - Mouse ENSMUSG00000031885
Gene ID - Rat ENSRNOG00000014647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBFB pAb (ATL-HPA038852 w/enhanced validation)
Datasheet Anti CBFB pAb (ATL-HPA038852 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CBFB pAb (ATL-HPA038852 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CBFB pAb (ATL-HPA038852 w/enhanced validation)
Datasheet Anti CBFB pAb (ATL-HPA038852 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CBFB pAb (ATL-HPA038852 w/enhanced validation)