Anti CBFB pAb (ATL-HPA038852 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038852-25

Protein Description: core-binding factor, beta subunit
Gene Name: CBFB
Alternative Gene Name: PEBP2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031885: 99%, ENSRNOG00000014647: 99%
Entrez Gene ID: 865
Uniprot ID: Q13951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV
• Gene Sequence: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV
• Gene ID - Mouse: ENSMUSG00000031885
• Gene ID - Rat: ENSRNOG00000014647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.