Anti CBFA2T3 pAb (ATL-HPA059931)

Atlas Antibodies

Catalog No.:
ATL-HPA059931-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: core-binding factor, runt domain, alpha subunit 2; translocated to, 3
Gene Name: CBFA2T3
Alternative Gene Name: MTG16, MTGR2, ZMYND4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006362: 42%, ENSRNOG00000014723: 45%
Entrez Gene ID: 863
Uniprot ID: O75081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR
Gene Sequence SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR
Gene ID - Mouse ENSMUSG00000006362
Gene ID - Rat ENSRNOG00000014723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CBFA2T3 pAb (ATL-HPA059931)
Datasheet Anti CBFA2T3 pAb (ATL-HPA059931) Datasheet (External Link)
Vendor Page Anti CBFA2T3 pAb (ATL-HPA059931) at Atlas Antibodies

Documents & Links for Anti CBFA2T3 pAb (ATL-HPA059931)
Datasheet Anti CBFA2T3 pAb (ATL-HPA059931) Datasheet (External Link)
Vendor Page Anti CBFA2T3 pAb (ATL-HPA059931)