Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044810-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: caveolin 2
Gene Name: CAV2
Alternative Gene Name: CAV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000058: 82%, ENSRNOG00000057713: 82%
Entrez Gene ID: 858
Uniprot ID: P51636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIA
Gene Sequence GLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIA
Gene ID - Mouse ENSMUSG00000000058
Gene ID - Rat ENSRNOG00000057713
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation)
Datasheet Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation)
Datasheet Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAV2 pAb (ATL-HPA044810 w/enhanced validation)