Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049326-100
- Shipping:
- Calculated at Checkout
$486.00
Gene Name: CAV1
Alternative Gene Name: CAV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007655: 88%, ENSRNOG00000056836: 88%
Entrez Gene ID: 857
Uniprot ID: Q03135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI |
Gene Sequence | LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI |
Gene ID - Mouse | ENSMUSG00000007655 |
Gene ID - Rat | ENSRNOG00000056836 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) | |
Datasheet | Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) | |
Datasheet | Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) |
Citations for Anti CAV1 pAb (ATL-HPA049326 w/enhanced validation) – 4 Found |
Jozic, Ivan; Abujamra, Beatriz Abdo; Elliott, Michael H; Wikramanayake, Tongyu C; Marjanovic, Jelena; Stone, Rivka C; Head, Cheyanne R; Pastar, Irena; Kirsner, Robert S; Andreopoulos, Fotios M; Musi, Juan P; Tomic-Canic, Marjana. Glucocorticoid-mediated induction of caveolin-1 disrupts cytoskeletal organization, inhibits cell migration and re-epithelialization of non-healing wounds. Communications Biology. 2021;4(1):757. PubMed |
Jozic, Ivan; Sawaya, Andrew P; Pastar, Irena; Head, Cheyanne R; Wong, Lulu L; Glinos, George D; Wikramanayake, Tongyu Cao; Brem, Harold; Kirsner, Robert S; Tomic-Canic, Marjana. Pharmacological and Genetic Inhibition of Caveolin-1 Promotes Epithelialization and Wound Closure. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2019;27(11):1992-2004. PubMed |
Egger, Andjela N; Rajabiestarabadi, Ali; Williams, Natalie M; Resnik, Sydney R; Fox, Joshua D; Wong, Lulu L; Jozic, Ivan. The importance of caveolins and caveolae to dermatology: Lessons from the caves and beyond. Experimental Dermatology. 2020;29(2):136-148. PubMed |
Škara, Lucija; Vodopić, Tonći; Pezelj, Ivan; Abramovic, Irena; Vrhovec, Borna; Vrtarić, Alen; Sincic, Nino; Tomas, Davor; Bulimbašić, Stela; Kuliš, Tomislav; Ulamec, Monika. Methylation pattern of caveolin-1 in prostate cancer as potential cfDNA biomarker. Biomolecules & Biomedicine. 2023;23(1):176-186. PubMed |