Anti CATIP pAb (ATL-HPA044818)

Atlas Antibodies

Catalog No.:
ATL-HPA044818-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ciliogenesis associated TTC17 interacting protein
Gene Name: CATIP
Alternative Gene Name: C2orf62, MGC50811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073650: 80%, ENSRNOG00000037835: 81%
Entrez Gene ID: 375307
Uniprot ID: Q7Z7H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLD
Gene Sequence TIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLD
Gene ID - Mouse ENSMUSG00000073650
Gene ID - Rat ENSRNOG00000037835
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CATIP pAb (ATL-HPA044818)
Datasheet Anti CATIP pAb (ATL-HPA044818) Datasheet (External Link)
Vendor Page Anti CATIP pAb (ATL-HPA044818) at Atlas Antibodies

Documents & Links for Anti CATIP pAb (ATL-HPA044818)
Datasheet Anti CATIP pAb (ATL-HPA044818) Datasheet (External Link)
Vendor Page Anti CATIP pAb (ATL-HPA044818)
Citations for Anti CATIP pAb (ATL-HPA044818) – 1 Found
Bontems, Franck; Fish, Richard J; Borlat, Irene; Lembo, Frédérique; Chocu, Sophie; Chalmel, Frédéric; Borg, Jean-Paul; Pineau, Charles; Neerman-Arbez, Marguerite; Bairoch, Amos; Lane, Lydie. C2orf62 and TTC17 are involved in actin organization and ciliogenesis in zebrafish and human. Plos One. 9(1):e86476.  PubMed