Anti CATIP pAb (ATL-HPA044818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044818-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CATIP
Alternative Gene Name: C2orf62, MGC50811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073650: 80%, ENSRNOG00000037835: 81%
Entrez Gene ID: 375307
Uniprot ID: Q7Z7H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLD |
Gene Sequence | TIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLD |
Gene ID - Mouse | ENSMUSG00000073650 |
Gene ID - Rat | ENSRNOG00000037835 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CATIP pAb (ATL-HPA044818) | |
Datasheet | Anti CATIP pAb (ATL-HPA044818) Datasheet (External Link) |
Vendor Page | Anti CATIP pAb (ATL-HPA044818) at Atlas Antibodies |
Documents & Links for Anti CATIP pAb (ATL-HPA044818) | |
Datasheet | Anti CATIP pAb (ATL-HPA044818) Datasheet (External Link) |
Vendor Page | Anti CATIP pAb (ATL-HPA044818) |
Citations for Anti CATIP pAb (ATL-HPA044818) – 1 Found |
Bontems, Franck; Fish, Richard J; Borlat, Irene; Lembo, Frédérique; Chocu, Sophie; Chalmel, Frédéric; Borg, Jean-Paul; Pineau, Charles; Neerman-Arbez, Marguerite; Bairoch, Amos; Lane, Lydie. C2orf62 and TTC17 are involved in actin organization and ciliogenesis in zebrafish and human. Plos One. 9(1):e86476. PubMed |