Anti CAT pAb (ATL-HPA055838 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA055838-100
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/96895/175439/atl-hpa055838_anti-cat-pab-atl-hpa055838-wenhanced-validation_57098__78979.1681130208.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue")
- Shipping:
- Calculated at Checkout
$486.00
Gene Name: CAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027187: 84%, ENSRNOG00000008364: 78%
Entrez Gene ID: 847
Uniprot ID: P04040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHL |
| Gene Sequence | NTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHL |
| Gene ID - Mouse | ENSMUSG00000027187 |
| Gene ID - Rat | ENSRNOG00000008364 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAT pAb (ATL-HPA055838 w/enhanced validation) | |
| Datasheet | Anti CAT pAb (ATL-HPA055838 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAT pAb (ATL-HPA055838 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CAT pAb (ATL-HPA055838 w/enhanced validation) | |
| Datasheet | Anti CAT pAb (ATL-HPA055838 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAT pAb (ATL-HPA055838 w/enhanced validation) |
| Citations for Anti CAT pAb (ATL-HPA055838 w/enhanced validation) – 1 Found |
| Benfeitas, Rui; Bidkhori, Gholamreza; Mukhopadhyay, Bani; Klevstig, Martina; Arif, Muhammad; Zhang, Cheng; Lee, Sunjae; Cinar, Resat; Nielsen, Jens; Uhlen, Mathias; Boren, Jan; Kunos, George; Mardinoglu, Adil. Characterization of heterogeneous redox responses in hepatocellular carcinoma patients using network analysis. Ebiomedicine. 2019;40( 30606699):471-487. PubMed |